30S ribosomal protein S13 rpsM 126 aq_074 RS13_AQUAE Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P- sites (By similarity). MARIAGVDLPNNKRLEVALTYIYGIGWSRAREICEKTGIPCTKRVGELTPDELNTLRKFIDENYKVEGDLRREVQLNIKKLKDMGCYRGIRHARGLPVRGQQTRTNARTRKGKRKTVGGTKKAKAK